Skip to Content
  1. Tots els productes
  2. Tots els productes
  3. Amyloid Beta-Peptide (1-42) (Umano) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% : 10x1mg
-
Amyloid Beta-Peptide (1-42) (Umano) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% : 10x1mg

Amyloid Beta-Peptide (1-42) (Umano) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% : 10x1mg

https://www.omniscellula.net/web/image/product.template/48052/image_1920?unique=0dbac67

0,01 € 0.01 EUR 0,01 €

0,01 €

Not Available For Sale

Aquesta combinació no existeix.

Contacta'ns

Termes i Condicions
Garantia de retorn de 30 dies
Enviament: 2-3 dies laborables

Compartir

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.