Passa al contenuto

FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide; Purity: >98% : 500mg

https://www.omniscellula.net/web/image/product.template/51949/image_1920?unique=0dbac67

0,01 € 0.01 EUR 0,01 €

0,01 €

Not Available For Sale

Questa combinazione non esiste.

Termini e condizioni
Garanzia di rimborso di 30 giorni
Spedizione: 2-3 giorni lavorativi

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.